PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01264.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 625aa    MW: 71033.1 Da    PI: 6.3636
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01264.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.9e-103674041954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  Rsa1.0_01264.1_g00004.1 367 FEHflHPYPKESEKVMLAKQTGLSKNQVANWFINARVR 404
                              554459******************************88 PP

2BELL109.42.1e-35224295172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqelq+kk+kLl+l++eVdkrY+qy++q+++++ssFe+vag gsa+pYts+Al++iS hFr+L+d ++eq+
  Rsa1.0_01264.1_g00004.1 224 ERQELQSKKNKLLTLVDEVDKRYNQYYHQMEALASSFEIVAGFGSARPYTSVALNRISSHFRSLRDTMKEQV 295
                              79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.2E-41169293IPR006563POX domain
PfamPF075263.1E-40174290IPR006563POX domain
PROSITE profilePS5007112.519345408IPR001356Homeobox domain
SMARTSM003891.2E-9348412IPR001356Homeobox domain
CDDcd000862.79E-11348409No hitNo description
SuperFamilySSF466892.57E-17349415IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27351414IPR009057Homeodomain-like
PfamPF059201.4E-17365404IPR008422Homeobox KN domain
PfamPF021516.5E-5590616IPR001943UVR domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MAVYYPSNVN CYQQEPIYLL NHLHHQQQQP SSSSSSAAAA SFVGGENARN EMVFIPPTTT  60
TIGGGDVEVV TALPQNLNGD DVPVSSSELT FRDGRGLSLS LSTQILDYHH QYQPGLSLTP  120
NPSIPVIKET PPFSREMLLL GQSDPSSSGF AGFYNGYRYN ETSSGGGFMN MSSVLRSRYL  180
KPAQSLLDEV VSVKKEINHI RKKKKGEDFN NDSNGIPIEL STTERQELQS KKNKLLTLVD  240
EVDKRYNQYY HQMEALASSF EIVAGFGSAR PYTSVALNRI SSHFRSLRDT MKEQVQMMGE  300
KLGEKGGELS LEQQQGGGER IPRLRYLDQR LRQQRALHQQ FGMVRPSWRP QRGLPESSVS  360
ALRAWLFEHF LHPYPKESEK VMLAKQTGLS KNQVANWFIN ARVRLWKPMI EEMYKEEFDD  420
ASELLISKSS QEPNITTNQE DSSSQQQQEN NNNNLTYSSA EAKPNRTSGN EDDPPQQQQQ  480
MNRSADYDSL MNYHGFGPDD YQQDSRFSNG HHLHDFVIGI DNTRISVAYK PRTRGIMNIL  540
FAYGYNDGMR VIESGKLSKQ TPESDGSLYT ELDRPNGQPC LDTKEFDLLS NMMQAVDEER  600
YDEAAEYRDM LSYFQAKRKL RKYKL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15354412563Homeobox protein Meis2
3k2a_A1e-15354412563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416473.10.0hypothetical protein EUTSA_v10007267mg
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLE4MVQ30.0E4MVQ3_EUTHA; mRNA, clone: RTFL01-03-C02
TrEMBLV4MSR40.0V4MSR4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10